SCOPe 2.06: Domain d3u35c_: 3u35 C:

Lineage for d3u35c_ (3u35 C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.0: automated matches [191365] (1 protein)
   not a true family

6. Protein automated matches [190439] (20 species)
   not a true protein

7. Species Xanthomonas axonopodis [TaxId:92829] [256113] (2 PDB entries)

8. Domain d3u35c_: 3u35 C: [250081]
   automated match to d3dmbb_
   complexed with pge

Details for d3u35c_

PDB Entry: 3u35, 2.5 Å

PDB Description: crystal structure of the general stress fmn/fad binding protein from the phytopathogen xanthomonas citri

PDB Compounds: (C:) General stress protein

SCOPe Domain Sequences for d3u35c_:

Sequence; same for both SEQRES and ATOM records:

>d3u35c_ b.45.1.0 (C:) automated matches {Xanthomonas axonopodis [TaxId: 92829]}
dtkelqekfwkalksdrtvmlgldgvedgharpmtaqiegdsggpiwfftskdnaliaml
gqgrrvigafsskghdlfasisgslredtdpamvdrlwnpyvaawyeggktdpnlallrl
dadhaqiwlnessllagikvll

Timeline for d3u35c_:

• d3u35c_ first appeared in SCOPe 2.04
  
• d3u35c_ appears in SCOPe 2.05
  
• d3u35c_ appears in SCOPe 2.07
  
• d3u35c_ appears in the current release, SCOPe 2.08