Lineage for d3u2qa2 (3u2q A:205-296)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062960Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2062961Protein automated matches [226946] (26 species)
    not a true protein
  7. 2062996Species Escherichia coli K-12 [TaxId:83333] [256111] (3 PDB entries)
  8. 2063001Domain d3u2qa2: 3u2q A:205-296 [250073]
    Other proteins in same PDB: d3u2qa1, d3u2qa3
    automated match to d1efca1
    complexed with gdp, mg

Details for d3u2qa2

PDB Entry: 3u2q (more details), 2.7 Å

PDB Description: EF-Tu (Escherichia coli) in complex with NVP-LFF571
PDB Compounds: (A:) Elongation factor Tu 1

SCOPe Domain Sequences for d3u2qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u2qa2 b.43.3.0 (A:205-296) automated matches {Escherichia coli K-12 [TaxId: 83333]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOPe Domain Coordinates for d3u2qa2:

Click to download the PDB-style file with coordinates for d3u2qa2.
(The format of our PDB-style files is described here.)

Timeline for d3u2qa2: