Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (29 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [256110] (3 PDB entries) |
Domain d3u2qa1: 3u2q A:6-204 [250072] Other proteins in same PDB: d3u2qa2, d3u2qa3 automated match to d1d8ta3 complexed with gdp, mg |
PDB Entry: 3u2q (more details), 2.7 Å
SCOPe Domain Sequences for d3u2qa1:
Sequence, based on SEQRES records: (download)
>d3u2qa1 c.37.1.8 (A:6-204) automated matches {Escherichia coli K-12 [TaxId: 83333]} ertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitints hveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqv gvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaewe akilelagfldsyipeper
>d3u2qa1 c.37.1.8 (A:6-204) automated matches {Escherichia coli K-12 [TaxId: 83333]} ertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekatintshve ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki lelagfldsyipeper
Timeline for d3u2qa1: