Lineage for d3u2qa1 (3u2q A:6-204)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2125254Protein automated matches [190047] (29 species)
    not a true protein
  7. 2125306Species Escherichia coli K-12 [TaxId:83333] [256110] (3 PDB entries)
  8. 2125311Domain d3u2qa1: 3u2q A:6-204 [250072]
    Other proteins in same PDB: d3u2qa2, d3u2qa3
    automated match to d1d8ta3
    complexed with gdp, mg

Details for d3u2qa1

PDB Entry: 3u2q (more details), 2.7 Å

PDB Description: EF-Tu (Escherichia coli) in complex with NVP-LFF571
PDB Compounds: (A:) Elongation factor Tu 1

SCOPe Domain Sequences for d3u2qa1:

Sequence, based on SEQRES records: (download)

>d3u2qa1 c.37.1.8 (A:6-204) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitints
hveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqv
gvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaewe
akilelagfldsyipeper

Sequence, based on observed residues (ATOM records): (download)

>d3u2qa1 c.37.1.8 (A:6-204) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekatintshve
ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
lelagfldsyipeper

SCOPe Domain Coordinates for d3u2qa1:

Click to download the PDB-style file with coordinates for d3u2qa1.
(The format of our PDB-style files is described here.)

Timeline for d3u2qa1: