SCOPe 2.08: Domain d3u2qa1: 3u2q A:6-204

Lineage for d3u2qa1 (3u2q A:6-204)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [256110] (3 PDB entries)

8. Domain d3u2qa1: 3u2q A:6-204 [250072]
   Other proteins in same PDB: d3u2qa2, d3u2qa3
   automated match to d1d8ta3
   complexed with gdp, mg

Details for d3u2qa1

PDB Entry: 3u2q, 2.7 Å

PDB Description: EF-Tu (Escherichia coli) in complex with NVP-LFF571

PDB Compounds: (A:) Elongation factor Tu 1

SCOPe Domain Sequences for d3u2qa1:

Sequence, based on SEQRES records:

>d3u2qa1 c.37.1.8 (A:6-204) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitints
hveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqv
gvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaewe
akilelagfldsyipeper

Sequence, based on observed residues (ATOM records):

>d3u2qa1 c.37.1.8 (A:6-204) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekatintshve
ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
lelagfldsyipeper

Timeline for d3u2qa1:

• d3u2qa1 first appeared in SCOPe 2.04
  
• d3u2qa1 appears in SCOPe 2.07