SCOPe 2.08: Domain d3u2db_: 3u2d B:

Lineage for d3u2db_ (3u2d B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (22 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [232247] (22 PDB entries)

8. Domain d3u2db_: 3u2d B: [250069]
   automated match to d3ttza_
   complexed with 08b, mg

Details for d3u2db_

PDB Entry: 3u2d, 1.85 Å

PDB Description: s. aureus gyrb atpase domain in complex with small molecule inhibitor

PDB Compounds: (B:) DNA gyrase subunit b

SCOPe Domain Sequences for d3u2db_:

Sequence, based on SEQRES records:

>d3u2db_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
qvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikv
tdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdl
kevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenv
redsyhye

Sequence, based on observed residues (ATOM records):

>d3u2db_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
qvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikv
tdngrgipvdiqegrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlke
vgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvre
dsyhye

Timeline for d3u2db_:

• d3u2db_ first appeared in SCOPe 2.04
  
• d3u2db_ appears in SCOPe 2.07