| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
| Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
| Protein automated matches [226867] (11 species) not a true protein |
| Species Staphylococcus aureus [TaxId:1280] [232247] (9 PDB entries) |
| Domain d3u2da_: 3u2d A: [250068] automated match to d3ttza_ complexed with 08b, mg |
PDB Entry: 3u2d (more details), 1.85 Å
SCOPe Domain Sequences for d3u2da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u2da_ d.122.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ygagqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviek
dnwikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkg
vpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrde
rdeenvredsyhye
Timeline for d3u2da_: