Lineage for d3u2da_ (3u2d A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1667394Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1667395Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1667910Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 1667911Protein automated matches [226867] (11 species)
    not a true protein
  7. 1667973Species Staphylococcus aureus [TaxId:1280] [232247] (9 PDB entries)
  8. 1667978Domain d3u2da_: 3u2d A: [250068]
    automated match to d3ttza_
    complexed with 08b, mg

Details for d3u2da_

PDB Entry: 3u2d (more details), 1.85 Å

PDB Description: s. aureus gyrb atpase domain in complex with small molecule inhibitor
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d3u2da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u2da_ d.122.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ygagqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviek
dnwikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkg
vpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrde
rdeenvredsyhye

SCOPe Domain Coordinates for d3u2da_:

Click to download the PDB-style file with coordinates for d3u2da_.
(The format of our PDB-style files is described here.)

Timeline for d3u2da_: