SCOPe 2.08: Domain d3u0ob1: 3u0o B:13-162

Lineage for d3u0ob1 (3u0o B:13-162)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families)

5. Family d.79.4.0: automated matches [227181] (1 protein)
   not a true family

6. Protein automated matches [226901] (10 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [256107] (1 PDB entry)

8. Domain d3u0ob1: 3u0o B:13-162 [250062]
   Other proteins in same PDB: d3u0oa2, d3u0ob2
   automated match to d2yyea1
   complexed with mg

Details for d3u0ob1

PDB Entry: 3u0o, 2.25 Å

PDB Description: The crystal structure of selenophosphate synthetase from E. coli

PDB Compounds: (B:) Selenide, water dikinase

SCOPe Domain Sequences for d3u0ob1:

Sequence; same for both SEQRES and ATOM records:

>d3u0ob1 d.79.4.0 (B:13-162) automated matches {Escherichia coli K-12 [TaxId: 83333]}
hgagcgckispkvletilhseqakfvdpnllvgnetrddaavydlgngtsvisttdffmp
ivdnpfdfgriaatnaisdifamggkpimaiailgwpinklspeiarevteggryacrqa
gialagghsidapepifglavtgivpterv

Timeline for d3u0ob1:

• d3u0ob1 first appeared in SCOPe 2.04
  
• d3u0ob1 appears in SCOPe 2.07