SCOPe 2.08: Domain d3u0oa2: 3u0o A:163-347

Lineage for d3u0oa2 (3u0o A:163-347)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.0: automated matches [227182] (1 protein)
   not a true family

6. Protein automated matches [226902] (12 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [256108] (1 PDB entry)

8. Domain d3u0oa2: 3u0o A:163-347 [250061]
   Other proteins in same PDB: d3u0oa1, d3u0ob1
   automated match to d2zoda2
   complexed with mg

Details for d3u0oa2

PDB Entry: 3u0o, 2.25 Å

PDB Description: The crystal structure of selenophosphate synthetase from E. coli

PDB Compounds: (A:) Selenide, water dikinase

SCOPe Domain Sequences for d3u0oa2:

Sequence; same for both SEQRES and ATOM records:

>d3u0oa2 d.139.1.0 (A:163-347) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kknstaqagcklfltkplgigvlttaekksllkpehqglatevmcrmniagasfaniegv
kamtdvtgfgllghlsemcqgagvqarvdyeaipklpgveeyiklgavpggternfasyg
hlmgemprevrdllcdpqtsgglllavmpeaenevkataaefgieltaigelvparggra
mveir

Timeline for d3u0oa2:

• d3u0oa2 first appeared in SCOPe 2.04
  
• d3u0oa2 appears in SCOPe 2.07