![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d3tzvg2: 3tzv G:115-203 [250057] Other proteins in same PDB: d3tzva1, d3tzvb1, d3tzvb2, d3tzvc1, d3tzvc2, d3tzvd_, d3tzvg1, d3tzvh1, d3tzvh2 automated match to d2pyfa2 complexed with d12, gol, hex, lsc |
PDB Entry: 3tzv (more details), 3.06 Å
SCOPe Domain Sequences for d3tzvg2:
Sequence, based on SEQRES records: (download)
>d3tzvg2 b.1.1.2 (G:115-203) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
>d3tzvg2 b.1.1.2 (G:115-203) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqkdsdvyitdkcvldmrsmdfksnsa vawsnkdfacanafnnsiipedtffps
Timeline for d3tzvg2: