![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (472 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
![]() | Domain d3tzvd_: 3tzv D: [250055] Other proteins in same PDB: d3tzva1, d3tzva2, d3tzvb1, d3tzvb2, d3tzvc1, d3tzvc2, d3tzvg1, d3tzvg2, d3tzvh1, d3tzvh2 automated match to d1k5nb_ complexed with d12, fuc, gol, hex, lsc, nag |
PDB Entry: 3tzv (more details), 3.06 Å
SCOPe Domain Sequences for d3tzvd_:
Sequence, based on SEQRES records: (download)
>d3tzvd_ b.1.1.2 (D:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} qrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdws fyllyyteftptekdeyacrvnhvtlsqpkivkwdr
>d3tzvd_ b.1.1.2 (D:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} qrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdws fyllyyteftptedeyacrvnhvtlsqpkivkwdr
Timeline for d3tzvd_: