| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d3tzvc2: 3tzv C:184-278 [250054] Other proteins in same PDB: d3tzva2, d3tzvc1, d3tzvd_, d3tzvg2 automated match to d3hujc2 complexed with d12, gol, hex, lsc |
PDB Entry: 3tzv (more details), 3.06 Å
SCOPe Domain Sequences for d3tzvc2:
Sequence, based on SEQRES records: (download)
>d3tzvc2 b.1.1.0 (C:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlyw
>d3tzvc2 b.1.1.0 (C:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpkawlsrgpsplllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetwylra
tldvvaaglscrvkhsslegqdivlyw
Timeline for d3tzvc2: