SCOPe 2.08: Domain d3tzvc1: 3tzv C:8-183

Lineage for d3tzvc1 (3tzv C:8-183)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (15 PDB entries)

8. Domain d3tzvc1: 3tzv C:8-183 [250053]
   Other proteins in same PDB: d3tzva1, d3tzva2, d3tzvb1, d3tzvb2, d3tzvc2, d3tzvd_, d3tzvg1, d3tzvg2, d3tzvh1, d3tzvh2
   automated match to d3hujc1
   complexed with d12, gol, hex, lsc

Details for d3tzvc1

PDB Entry: 3tzv, 3.06 Å

PDB Description: crystal structure of an inkt tcr in complex with cd1d- lysophosphatidylcholine

PDB Compounds: (C:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d3tzvc1:

Sequence; same for both SEQRES and ATOM records:

>d3tzvc1 d.19.1.1 (C:8-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
fplrclqissfansswtrtdglawlgelqthswsqdsdtvrslkpwsqgtfsdqqwetlq
hifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgqasnnffhvafqgkdilsfq
gtsweptqeaplwvnlaiqvlnqdkwtretvqwllqgtcpqfvsgllesgkselkk

Timeline for d3tzvc1:

• d3tzvc1 first appeared in SCOPe 2.04
  
• d3tzvc1 appears in SCOPe 2.07