Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (15 PDB entries) |
Domain d3tzvc1: 3tzv C:8-183 [250053] Other proteins in same PDB: d3tzva1, d3tzva2, d3tzvb1, d3tzvb2, d3tzvc2, d3tzvd_, d3tzvg1, d3tzvg2, d3tzvh1, d3tzvh2 automated match to d3hujc1 complexed with d12, gol, hex, lsc |
PDB Entry: 3tzv (more details), 3.06 Å
SCOPe Domain Sequences for d3tzvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tzvc1 d.19.1.1 (C:8-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]} fplrclqissfansswtrtdglawlgelqthswsqdsdtvrslkpwsqgtfsdqqwetlq hifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgqasnnffhvafqgkdilsfq gtsweptqeaplwvnlaiqvlnqdkwtretvqwllqgtcpqfvsgllesgkselkk
Timeline for d3tzvc1: