SCOPe 2.06: Domain d3tzva2: 3tzv A:115-200

Lineage for d3tzva2 (3tzv A:115-200)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d3tzva2: 3tzv A:115-200 [250050]
   Other proteins in same PDB: d3tzva1, d3tzvb1, d3tzvb2, d3tzvc1, d3tzvc2, d3tzvd_, d3tzvg1, d3tzvh1, d3tzvh2
   automated match to d2pyfa2
   complexed with d12, gol, hex, lsc

Details for d3tzva2

PDB Entry: 3tzv, 3.06 Å

PDB Description: crystal structure of an inkt tcr in complex with cd1d- lysophosphatidylcholine

PDB Compounds: (A:) Invariant Natural Killer T Cell Receptor chain A

SCOPe Domain Sequences for d3tzva2:

Sequence, based on SEQRES records:

>d3tzva2 b.1.1.2 (A:115-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtf

Sequence, based on observed residues (ATOM records):

>d3tzva2 b.1.1.2 (A:115-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsksksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsav
awsnksdfacanafnnsiipedtf

Timeline for d3tzva2:

• d3tzva2 first appeared in SCOPe 2.04
  
• d3tzva2 appears in SCOPe 2.05
  
• d3tzva2 appears in SCOPe 2.07
  
• d3tzva2 appears in the current release, SCOPe 2.08