Lineage for d3tzva1 (3tzv A:1-114)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1520238Domain d3tzva1: 3tzv A:1-114 [250049]
    Other proteins in same PDB: d3tzva2, d3tzvc1, d3tzvd_, d3tzvg2
    automated match to d2pyfa1
    complexed with d12, gol, hex, lsc

Details for d3tzva1

PDB Entry: 3tzv (more details), 3.06 Å

PDB Description: crystal structure of an inkt tcr in complex with cd1d- lysophosphatidylcholine
PDB Compounds: (A:) Invariant Natural Killer T Cell Receptor chain A

SCOPe Domain Sequences for d3tzva1:

Sequence, based on SEQRES records: (download)

>d3tzva1 b.1.1.0 (A:1-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentksngr
ytatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpd

Sequence, based on observed residues (ATOM records): (download)

>d3tzva1 b.1.1.0 (A:1-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentksngr
ytatldadtkqsslhitasqlsdsasyicvvsdrtlgrlyfgrgtqltvwpd

SCOPe Domain Coordinates for d3tzva1:

Click to download the PDB-style file with coordinates for d3tzva1.
(The format of our PDB-style files is described here.)

Timeline for d3tzva1: