Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein c-src tyrosine kinase [56155] (2 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
Species Chicken (Gallus gallus) [TaxId:9031] [56157] (35 PDB entries) |
Domain d3tz9b_: 3tz9 B: [250048] automated match to d3geqa_ complexed with aqu |
PDB Entry: 3tz9 (more details), 3.1 Å
SCOPe Domain Sequences for d3tz9b_:
Sequence, based on SEQRES records: (download)
>d3tz9b_ d.144.1.7 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]} kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk lrheklvqlyavvseepiyivteymskgclldflkgemgkylrlpqlvdmaaqiasgmay vermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaaly grftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmc qcwrkdpeerptfeylqafledyftstepqyqpgenl
>d3tz9b_ d.144.1.7 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]} kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk lrheklvqlyavvseepiyivteymskgclldflkgemgkylrlpqlvdmaaqiasgmay vermnyvhrdlraanilvgenlvckvadffpikwtapeaalygrftiksdvwsfgillte lttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqa fledyftstepqyqpgenl
Timeline for d3tz9b_: