Lineage for d3tu5a1 (3tu5 A:4-146)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858889Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225907] (8 PDB entries)
  8. 1858895Domain d3tu5a1: 3tu5 A:4-146 [250033]
    Other proteins in same PDB: d3tu5a2, d3tu5b_
    automated match to d1c0fa1
    complexed with atp, ca, mpd

Details for d3tu5a1

PDB Entry: 3tu5 (more details), 3 Å

PDB Description: actin complex with gelsolin segment 1 fused to cobl segment
PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d3tu5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tu5a1 c.55.1.0 (A:4-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim
fetfnvpamyvaiqavlslyasg

SCOPe Domain Coordinates for d3tu5a1:

Click to download the PDB-style file with coordinates for d3tu5a1.
(The format of our PDB-style files is described here.)

Timeline for d3tu5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tu5a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3tu5b_