![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (49 species) not a true protein |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225907] (8 PDB entries) |
![]() | Domain d3tu5a1: 3tu5 A:4-146 [250033] Other proteins in same PDB: d3tu5a2, d3tu5b_ automated match to d1c0fa1 complexed with atp, ca, mpd |
PDB Entry: 3tu5 (more details), 3 Å
SCOPe Domain Sequences for d3tu5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tu5a1 c.55.1.0 (A:4-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim fetfnvpamyvaiqavlslyasg
Timeline for d3tu5a1: