Lineage for d1fgbg_ (1fgb G:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 296865Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 296866Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 296867Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 296868Species Vibrio cholerae [TaxId:666] [50209] (12 PDB entries)
  8. 296922Domain d1fgbg_: 1fgb G: [25003]

Details for d1fgbg_

PDB Entry: 1fgb (more details), 2.4 Å

PDB Description: toxin

SCOP Domain Sequences for d1fgbg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fgbg_ b.40.2.1 (G:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOP Domain Coordinates for d1fgbg_:

Click to download the PDB-style file with coordinates for d1fgbg_.
(The format of our PDB-style files is described here.)

Timeline for d1fgbg_: