| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
| Domain d3tt1m2: 3tt1 M:112-215 [250026] Other proteins in same PDB: d3tt1a_, d3tt1b_, d3tt1h1, d3tt1h2, d3tt1i1, d3tt1i2, d3tt1l1, d3tt1m1 automated match to d1tqbc2 complexed with na, sog |
PDB Entry: 3tt1 (more details), 3.1 Å
SCOPe Domain Sequences for d3tt1m2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tt1m2 b.1.1.2 (M:112-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d3tt1m2: