SCOPe 2.08: Domain d3tt1m2: 3tt1 M:112-215

Lineage for d3tt1m2 (3tt1 M:112-215)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d3tt1m2: 3tt1 M:112-215 [250026]
Other proteins in same PDB: d3tt1a_, d3tt1b_, d3tt1h1, d3tt1h2, d3tt1i1, d3tt1i2, d3tt1l1, d3tt1m1
automated match to d1tqbc2
complexed with na, sog

Details for d3tt1m2

PDB Entry: 3tt1 (more details), 3.1 Å

PDB Description: crystal structure of leut in the outward-open conformation in complex with fab

PDB Compounds: (M:) mouse monoclonal 1gG2a Fab fragment, heavy chain

SCOPe Domain Sequences for d3tt1m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tt1m2 b.1.1.2 (M:112-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d3tt1m2:

Click to download the PDB-style file with coordinates for d3tt1m2.
(The format of our PDB-style files is described here.)

Timeline for d3tt1m2: