SCOPe 2.06: Domain d3tt0a_: 3tt0 A:

Lineage for d3tt0a_ (3tt0 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Fibroblast growth factor receptor 1 [56158] (1 species)
   PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56159] (32 PDB entries)

8. Domain d3tt0a_: 3tt0 A: [250019]
   automated match to d4nkab_
   complexed with 07j, gol, so4

Details for d3tt0a_

PDB Entry: 3tt0, 2.8 Å

PDB Description: Co-structure of Fibroblast Growth Factor Receptor 1 kinase domain with 3-(2,6-dichloro-3,5-dimethoxy-phenyl)-1-{6-[4-(4-ethyl-piperazin-1-yl)-phenylamino]-pyrimidin-4-yl}-1-methyl-urea (BGJ398)

PDB Compounds: (A:) Basic fibroblast growth factor receptor 1

SCOPe Domain Sequences for d3tt0a_:

Sequence; same for both SEQRES and ATOM records:

>d3tt0a_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
seyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksda
tekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppg
leysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkia
dfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggsp
ypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrival
tsnqe

Timeline for d3tt0a_:

• d3tt0a_ first appeared in SCOPe 2.04
  
• d3tt0a_ appears in SCOPe 2.05
  
• d3tt0a_ appears in SCOPe 2.07
  
• d3tt0a_ appears in the current release, SCOPe 2.08