Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Fibroblast growth factor receptor 1 [56158] (1 species) PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56159] (29 PDB entries) |
Domain d3tt0a_: 3tt0 A: [250019] automated match to d4nkab_ complexed with 07j, gol, so4 |
PDB Entry: 3tt0 (more details), 2.8 Å
SCOPe Domain Sequences for d3tt0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tt0a_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} seyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksda tekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppg leysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkia dfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggsp ypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrival tsnqe
Timeline for d3tt0a_: