Lineage for d3tsxj_ (3tsx J:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409884Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2410852Superfamily b.121.5: ssDNA viruses [88645] (3 families) (S)
  5. 2410871Family b.121.5.2: Parvoviridae-like VP [88646] (3 proteins)
    automatically mapped to Pfam PF00740
  6. 2410897Protein automated matches [190920] (7 species)
    not a true protein
  7. 2410910Species Adeno-associated virus - 6 [TaxId:68558] [254925] (5 PDB entries)
  8. 2410981Domain d3tsxj_: 3tsx J: [250008]

Details for d3tsxj_

PDB Entry: 3tsx (more details), 3 Å

PDB Description: Structure-function Analysis of Receptor-binding in Adeno-Associated Virus Serotype 6 (AAV-6)
PDB Compounds: (J:) Capsid protein VP1

SCOPe Domain Sequences for d3tsxj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tsxj_ b.121.5.2 (J:) automated matches {Adeno-associated virus - 6 [TaxId: 68558]}
gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
pevqytsnyaksanvdftvdnnglyteprpigtryltrpl

SCOPe Domain Coordinates for d3tsxj_:

Click to download the PDB-style file with coordinates for d3tsxj_.
(The format of our PDB-style files is described here.)

Timeline for d3tsxj_: