![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
![]() | Protein automated matches [196409] (30 species) not a true protein |
![]() | Species Methylococcus capsulatus [TaxId:414] [256105] (1 PDB entry) |
![]() | Domain d3ts7b_: 3ts7 B: [249997] automated match to d4f62a_ complexed with po4 |
PDB Entry: 3ts7 (more details), 1.94 Å
SCOPe Domain Sequences for d3ts7b_:
Sequence, based on SEQRES records: (download)
>d3ts7b_ a.128.1.0 (B:) automated matches {Methylococcus capsulatus [TaxId: 414]} nperslsdfmrssqerveraldarlpaadrmperlhqamrysvlgggkrmrplltyatgq tigvaadlldgpacavefihvyslihddlpamddddlrrgkptchkaydeatailagdgl qalafhvlaqdpsiavpaenriamietlakasgpagmvggqaidlasvgkkldlpglenm hirktgalirasvrlaclarpglpaeqfdrldhyakciglafqiqddildeesdtqtlgk trgkdrdhnkpnypallglsgakekaeemheaaleslagfgpeadllrelarfiiqrqsa enlyfqsh
>d3ts7b_ a.128.1.0 (B:) automated matches {Methylococcus capsulatus [TaxId: 414]} nperslsdfmrssqerveraldarlpaadrmperlhqamrysvlgggkrmrplltyatgq tigvaadlldgpacavefihvyslihddlpamddddlrrgkptchkaydeatailagdgl qalafhvlaqdpsiavpaenriamietlakasgpagmvggqaidlasvgkkldlpglenm hirktgalirasvrlaclarpglpaeqfdrldhyakciglafqiqddildeesdtqtlkp nypallglsgakekaeemheaaleslagfgpeadllrelarfiiqrqsaenlyfqsh
Timeline for d3ts7b_: