SCOPe 2.05: Domain d3tqyd_: 3tqy D:

Lineage for d3tqyd_ (3tqy D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (23 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:777] [233711] (2 PDB entries)

8. Domain d3tqyd_: 3tqy D: [249993]
   automated match to d3ullb_

Details for d3tqyd_

PDB Entry: 3tqy, 2.6 Å

PDB Description: structure of a single-stranded dna-binding protein (ssb), from coxiella burnetii

PDB Compounds: (D:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d3tqyd_:

Sequence, based on SEQRES records:

>d3tqyd_ b.40.4.0 (D:) automated matches {Coxiella burnetii [TaxId: 777]}
rgvnkvilignlgqdpevrytpngnavanvtlatsttwrdkqtgelqertewhriaffnr
laeivgeylrkgskiyiegslrtrkwqdkngvdrytteiianemhmld

Sequence, based on observed residues (ATOM records):

>d3tqyd_ b.40.4.0 (D:) automated matches {Coxiella burnetii [TaxId: 777]}
rgvnkvilignlgqdpevrytpngnavanvtlatsttertewhriaffnrlaeivgeylr
kgskiyiegslrtrkwqdkngvdrytteiianemhmld

Timeline for d3tqyd_:

• d3tqyd_ first appeared in SCOPe 2.04
  
• d3tqyd_ appears in SCOPe 2.06
  
• d3tqyd_ appears in the current release, SCOPe 2.08