Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
Protein automated matches [190116] (24 species) not a true protein |
Species Coxiella burnetii [TaxId:777] [256103] (1 PDB entry) |
Domain d3tqic2: 3tqi C:208-403 [249985] Other proteins in same PDB: d3tqia1, d3tqia3, d3tqib1, d3tqib3, d3tqic1, d3tqic3, d3tqid1, d3tqid3 automated match to d1gpma1 |
PDB Entry: 3tqi (more details), 2.84 Å
SCOPe Domain Sequences for d3tqic2:
Sequence, based on SEQRES records: (download)
>d3tqic2 c.26.2.0 (C:208-403) automated matches {Coxiella burnetii [TaxId: 777]} wttkhiiedsirdiqekvgkeqvivglsggvdsavtatlvhkaigdqlvcvlvdtgllrl nevdevlnvfqkhlgakvicvdakdrfmkalkgisdpeekrkiageqfirvfeeqakkln vkwlgqgtiypdviesaktktgkghiikthhnvgglplnmelklieplrelfkdevrklg lelglpadliyrhpfp
>d3tqic2 c.26.2.0 (C:208-403) automated matches {Coxiella burnetii [TaxId: 777]} wttkhiiedsirdiqekvgkeqvivglsggvdsavtatlvhkaigdqlvcvlvdtgllrl nevdevlnvfqkhlgakvicvdakdrfmkalkgisdpeekrkiageqfirvfeeqakkln vkwlgqgtiypdviesklieplrelfkdevrklglelglpadliyrhpfp
Timeline for d3tqic2: