Lineage for d1chqg_ (1chq G:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13632Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 13633Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 13634Protein Cholera toxin [50208] (1 species)
  7. 13635Species Vibrio cholerae [TaxId:666] [50209] (8 PDB entries)
  8. 13664Domain d1chqg_: 1chq G: [24998]

Details for d1chqg_

PDB Entry: 1chq (more details), 2.1 Å

PDB Description: surprising leads for a cholera toxin receptor binding antagonist; crystallographic studies of ctb mutants

SCOP Domain Sequences for d1chqg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chqg_ b.40.2.1 (G:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslagkdemaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOP Domain Coordinates for d1chqg_:

Click to download the PDB-style file with coordinates for d1chqg_.
(The format of our PDB-style files is described here.)

Timeline for d1chqg_: