Lineage for d3tqia2 (3tqi A:208-403)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590910Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1591169Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 1591170Protein automated matches [190116] (16 species)
    not a true protein
  7. 1591187Species Coxiella burnetii [TaxId:777] [256103] (1 PDB entry)
  8. 1591188Domain d3tqia2: 3tqi A:208-403 [249979]
    Other proteins in same PDB: d3tqia1, d3tqia3, d3tqib1, d3tqib3, d3tqic1, d3tqic3, d3tqid1, d3tqid3
    automated match to d1gpma1

Details for d3tqia2

PDB Entry: 3tqi (more details), 2.84 Å

PDB Description: structure of the gmp synthase (guaa) from coxiella burnetii
PDB Compounds: (A:) GMP synthase [glutamine-hydrolyzing]

SCOPe Domain Sequences for d3tqia2:

Sequence, based on SEQRES records: (download)

>d3tqia2 c.26.2.0 (A:208-403) automated matches {Coxiella burnetii [TaxId: 777]}
wttkhiiedsirdiqekvgkeqvivglsggvdsavtatlvhkaigdqlvcvlvdtgllrl
nevdevlnvfqkhlgakvicvdakdrfmkalkgisdpeekrkiageqfirvfeeqakkln
vkwlgqgtiypdviesaktktgkghiikthhnvgglplnmelklieplrelfkdevrklg
lelglpadliyrhpfp

Sequence, based on observed residues (ATOM records): (download)

>d3tqia2 c.26.2.0 (A:208-403) automated matches {Coxiella burnetii [TaxId: 777]}
wttkhiiedsirdiqekvgkeqvivglsggvdsavtatlvhkaigdqlvcvlvdtgllrl
nevdevlnvfqkhlgakvicvdakdrfmkalkgisdpeekrkiageqfirvfeeqakkln
vkwlgqgtiypdviesklieplrelfkdevrklglelglpadliyrhpfp

SCOPe Domain Coordinates for d3tqia2:

Click to download the PDB-style file with coordinates for d3tqia2.
(The format of our PDB-style files is described here.)

Timeline for d3tqia2: