Lineage for d3to4d2 (3to4 D:122-247)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517986Domain d3to4d2: 3to4 D:122-247 [249971]
    Other proteins in same PDB: d3to4a1, d3to4a2, d3to4b_, d3to4c1, d3to4d1
    automated match to d1ogae2
    complexed with agh, nag

Details for d3to4d2

PDB Entry: 3to4 (more details), 3.1 Å

PDB Description: Structure of mouse Valpha14Vbeta2-mouseCD1d-alpha-Galactosylceramide
PDB Compounds: (D:) NKT Vbeta2 (MOUSE VARIABLE DOMAIN, HUMAN CONSTANT DOMAIN)

SCOPe Domain Sequences for d3to4d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3to4d2 b.1.1.2 (D:122-247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk
eqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae
awgrad

SCOPe Domain Coordinates for d3to4d2:

Click to download the PDB-style file with coordinates for d3to4d2.
(The format of our PDB-style files is described here.)

Timeline for d3to4d2: