![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (16 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1138 PDB entries) |
![]() | Domain d3to4d2: 3to4 D:122-247 [249971] Other proteins in same PDB: d3to4a1, d3to4a2, d3to4a3, d3to4b_, d3to4c1, d3to4d1 automated match to d1ogae2 complexed with agh, nag |
PDB Entry: 3to4 (more details), 3.1 Å
SCOPe Domain Sequences for d3to4d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3to4d2 b.1.1.2 (D:122-247) automated matches {Human (Homo sapiens) [TaxId: 9606]} nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk eqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae awgrad
Timeline for d3to4d2: