Lineage for d3to4d1 (3to4 D:3-121)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2357349Domain d3to4d1: 3to4 D:3-121 [249970]
    Other proteins in same PDB: d3to4a1, d3to4a3, d3to4b_, d3to4c2, d3to4d2
    automated match to d1ogae1
    complexed with agh, nag

Details for d3to4d1

PDB Entry: 3to4 (more details), 3.1 Å

PDB Description: Structure of mouse Valpha14Vbeta2-mouseCD1d-alpha-Galactosylceramide
PDB Compounds: (D:) NKT Vbeta2 (MOUSE VARIABLE DOMAIN, HUMAN CONSTANT DOMAIN)

SCOPe Domain Sequences for d3to4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3to4d1 b.1.1.0 (D:3-121) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevkslp
gadylatrvtdtelrlqvanmsqgrtlyctssadhwtntgqlyfgegskltvledlk

SCOPe Domain Coordinates for d3to4d1:

Click to download the PDB-style file with coordinates for d3to4d1.
(The format of our PDB-style files is described here.)

Timeline for d3to4d1: