Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d3to4c2: 3to4 C:118-207 [249969] Other proteins in same PDB: d3to4a1, d3to4a2, d3to4a3, d3to4b_, d3to4c1, d3to4d1 automated match to d4eura2 complexed with agh, nag |
PDB Entry: 3to4 (more details), 3.1 Å
SCOPe Domain Sequences for d3to4c2:
Sequence, based on SEQRES records: (download)
>d3to4c2 b.1.1.2 (C:118-207) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns avawsnksdfacanafnnsiipedtffpsp
>d3to4c2 b.1.1.2 (C:118-207) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtvyitdktvldfksnsavawsnksdfacan afnnsiipedtffpsp
Timeline for d3to4c2: