Lineage for d3to4c2 (3to4 C:118-207)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2024406Species Human (Homo sapiens) [TaxId:9606] [187221] (683 PDB entries)
  8. 2025272Domain d3to4c2: 3to4 C:118-207 [249969]
    Other proteins in same PDB: d3to4a1, d3to4a2, d3to4a3, d3to4b_, d3to4c1, d3to4d1
    automated match to d4eura2
    complexed with agh, nag

Details for d3to4c2

PDB Entry: 3to4 (more details), 3.1 Å

PDB Description: Structure of mouse Valpha14Vbeta2-mouseCD1d-alpha-Galactosylceramide
PDB Compounds: (C:) NKT Valpha14 (MOUSE VARIABLE DOMAIN, HUMAN CONSTANT DOMAIN)

SCOPe Domain Sequences for d3to4c2:

Sequence, based on SEQRES records: (download)

>d3to4c2 b.1.1.2 (C:118-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Sequence, based on observed residues (ATOM records): (download)

>d3to4c2 b.1.1.2 (C:118-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtvyitdktvldfksnsavawsnksdfacan
afnnsiipedtffpsp

SCOPe Domain Coordinates for d3to4c2:

Click to download the PDB-style file with coordinates for d3to4c2.
(The format of our PDB-style files is described here.)

Timeline for d3to4c2: