SCOPe 2.06: Domain d3tn4a_: 3tn4 A:

Lineage for d3tn4a_ (3tn4 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (26 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:1462] [189526] (16 PDB entries)

8. Domain d3tn4a_: 3tn4 A: [249955]
   automated match to d3orwa_
   complexed with co; mutant

Details for d3tn4a_

PDB Entry: 3tn4, 1.5 Å

PDB Description: Crystal structure of GkaP mutant G209D from Geobacillus kaustophilus HTA426

PDB Compounds: (A:) phosphotriesterase

SCOPe Domain Sequences for d3tn4a_:

Sequence; same for both SEQRES and ATOM records:

>d3tn4a_ c.1.9.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
emvetvcgpvpveqlgktlihehflfgypgfqgdvtrgtfredeslrvaveaaekmkrhg
iqtvvdptpndcgrnpaflrrvaeetglniicatgyyyegegappyfqfrrllgtaeddi
ydmfmaeltegiadtgikagviklasskgriteyekmffraaaraqketgaviithtqeg
tmgpeqaayllehgadpkkivighmcdntdpdyhrktlaygvyiafdrfgiqgmvgaptd
eervrtllallrdgyekqimlshdtvnvwlgrpftlpepfaemmknwhvehlfvniipal
knegirdevleqmfignpaalfsa

Timeline for d3tn4a_:

• d3tn4a_ first appeared in SCOPe 2.04
  
• d3tn4a_ appears in SCOPe 2.05
  
• d3tn4a_ appears in SCOPe 2.07
  
• d3tn4a_ appears in the current release, SCOPe 2.08