SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3tksc_ (3tks C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118053Family c.47.1.10: Glutathione peroxidase-like [52901] (29 protein domains)
  6. 2118396Protein automated matches [190100] (19 species)
    not a true protein
  7. 2118578Species Human (Homo sapiens) [TaxId:9606] [187259] (19 PDB entries)
  8. 2118620Domain d3tksc_: 3tks C: [249946]
    automated match to d1qmva_
    complexed with per

Details for d3tksc_

PDB Entry: 3tks (more details), 2.4 Å

PDB Description: Crystal structure of full-length human peroxiredoxin 4 in three different redox states
PDB Compounds: (C:) Peroxiredoxin-4

SCOPe Domain Sequences for d3tksc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tksc_ c.47.1.10 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hlskakiskpapywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdr
leefrsintevvacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyled
sghtlrglfiiddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgse
tiipdpagklkyfdkln

SCOPe Domain Coordinates for d3tksc_:

Click to download the PDB-style file with coordinates for d3tksc_.
(The format of our PDB-style files is described here.)

Timeline for d3tksc_: