Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187259] (16 PDB entries) |
Domain d3tkqd_: 3tkq D: [249932] automated match to d1qmva_ |
PDB Entry: 3tkq (more details), 2.22 Å
SCOPe Domain Sequences for d3tkqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tkqd_ c.47.1.10 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} skakiskpapywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdrle efrsintevvacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyledsg htlrglfiiddkgilrqitlndlpvgrsvdetlrlvqafqytdkh
Timeline for d3tkqd_:
View in 3D Domains from other chains: (mouse over for more information) d3tkqa_, d3tkqb_, d3tkqc_, d3tkqe_ |