Lineage for d3tkpc_ (3tkp C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1601496Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1601835Protein automated matches [190100] (16 species)
    not a true protein
  7. 1601995Species Human (Homo sapiens) [TaxId:9606] [187259] (16 PDB entries)
  8. 1602032Domain d3tkpc_: 3tkp C: [249926]
    automated match to d1qmva_

Details for d3tkpc_

PDB Entry: 3tkp (more details), 2.49 Å

PDB Description: crystal structure of full-length human peroxiredoxin 4 in the reduced form
PDB Compounds: (C:) Peroxiredoxin-4

SCOPe Domain Sequences for d3tkpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tkpc_ c.47.1.10 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hlskakiskpapywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdr
leefrsintevvacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyled
sghtlrglfiiddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgse
tiipdpagklkyfdk

SCOPe Domain Coordinates for d3tkpc_:

Click to download the PDB-style file with coordinates for d3tkpc_.
(The format of our PDB-style files is described here.)

Timeline for d3tkpc_: