Lineage for d3tk8c_ (3tk8 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2813856Family b.81.1.2: Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD [51165] (2 proteins)
    contains extra N-terminal 3-helical domain
    this is a repeat family; one repeat unit is 6amy A:120-137 found in domain
  6. 2813873Protein automated matches [191042] (5 species)
    not a true protein
  7. 2813883Species Burkholderia pseudomallei [TaxId:320372] [256099] (1 PDB entry)
  8. 2813886Domain d3tk8c_: 3tk8 C: [249923]
    automated match to d3bxya_
    complexed with edo, so4, unl

Details for d3tk8c_

PDB Entry: 3tk8 (more details), 1.8 Å

PDB Description: structure of a 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate n- succinyltransferase from burkholderia pseudomallei
PDB Compounds: (C:) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase

SCOPe Domain Sequences for d3tk8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tk8c_ b.81.1.2 (C:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
sqqlqqiidnawenraelspkaasaeireavahaieqldrgalrvaekidgawtvhqwlk
kavllsfrlednapmpaggysqfydkvpskfanytaedfaaggfrvvppaiarrgsfiak
nvvlmpsytnigayvdegtmvdtwatvgscaqigknvhlsggvgiggvleplqanpviie
dncfigarsevvegviveensvismgvylgqstkiydretgevtygripagsvvvagnlp
akdgthslycavivkkvd

SCOPe Domain Coordinates for d3tk8c_:

Click to download the PDB-style file with coordinates for d3tk8c_.
(The format of our PDB-style files is described here.)

Timeline for d3tk8c_: