Lineage for d3tk8b_ (3tk8 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403213Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2403214Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2403226Family b.81.1.2: Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD [51165] (2 protein domains)
    contains extra N-terminal 3-helical domain
  6. 2403243Protein automated matches [191042] (4 species)
    not a true protein
  7. 2403246Species Burkholderia pseudomallei [TaxId:320372] [256099] (1 PDB entry)
  8. 2403248Domain d3tk8b_: 3tk8 B: [249922]
    automated match to d3bxya_
    complexed with edo, so4, unl

Details for d3tk8b_

PDB Entry: 3tk8 (more details), 1.8 Å

PDB Description: structure of a 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate n- succinyltransferase from burkholderia pseudomallei
PDB Compounds: (B:) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase

SCOPe Domain Sequences for d3tk8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tk8b_ b.81.1.2 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
sqqlqqiidnawenraelspkaasaeireavahaieqldrgalrvaekidgawtvhqwlk
kavllsfrlednapmpaggysqfydkvpskfanytaedfaaggfrvvppaiarrgsfiak
nvvlmpsytnigayvdegtmvdtwatvgscaqigknvhlsggvgiggvleplqanpviie
dncfigarsevvegviveensvismgvylgqstkiydretgevtygripagsvvvagnlp
akdgthslycavivkkv

SCOPe Domain Coordinates for d3tk8b_:

Click to download the PDB-style file with coordinates for d3tk8b_.
(The format of our PDB-style files is described here.)

Timeline for d3tk8b_: