Lineage for d3tjxa1 (3tjx A:1-312)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080389Protein automated matches [190228] (18 species)
    not a true protein
  7. 2080433Species Leishmania major [TaxId:5664] [255853] (6 PDB entries)
  8. 2080438Domain d3tjxa1: 3tjx A:1-312 [249919]
    Other proteins in same PDB: d3tjxa2, d3tjxb2
    automated match to d3c61a_
    complexed with fmn, gol, so4; mutant

Details for d3tjxa1

PDB Entry: 3tjx (more details), 1.64 Å

PDB Description: Crystal Structure of Leishmania major dihydroorotate dehydrogenase mutant H174A
PDB Compounds: (A:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d3tjxa1:

Sequence, based on SEQRES records: (download)

>d3tjxa1 c.1.4.1 (A:1-312) automated matches {Leishmania major [TaxId: 5664]}
mslqvnllnntfanpfmnaagvmcttteelvamtesasgslvsksctpalregnptpryq
alplgsinsmglpnngfdfylayaaeqhdygkkplflsmsglsmrenvemckrlaavate
kgvilelnlscpnvpgkpqvaydfdamrqcltavsevyphsfgvkmppyfdfaafdaaae
ilnefpkvqfitcinsignglvidaetesvvikpkqgfgglggryvlptalaninafyrr
cpgklifgcggvytgedaflhvlagasmvqvgtalqeegpsiferltsellgvmakkryq
tldefrgkvrtl

Sequence, based on observed residues (ATOM records): (download)

>d3tjxa1 c.1.4.1 (A:1-312) automated matches {Leishmania major [TaxId: 5664]}
mslqvnllnntfanpfmnaagvmcttteelvamtesasgslvsksctpalregnptpryq
alplgsinsmglpnngfdfylayaaeqhdygkkplflsmsglsmrenvemckrlaavate
kgvilelnlsvaydfdamrqcltavsevyphsfgvkmppyfdfaafdaaaeilnefpkvq
fitcinsignglvidaetesvvikpkqgfgglggryvlptalaninafyrrcpgklifgc
ggvytgedaflhvlagasmvqvgtalqeegpsiferltsellgvmakkryqtldefrgkv
rtl

SCOPe Domain Coordinates for d3tjxa1:

Click to download the PDB-style file with coordinates for d3tjxa1.
(The format of our PDB-style files is described here.)

Timeline for d3tjxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tjxa2