Lineage for d3tjnb_ (3tjn B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2390288Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2390289Protein automated matches [190438] (26 species)
    not a true protein
  7. 2390333Species Human (Homo sapiens) [TaxId:9606] [187421] (76 PDB entries)
  8. 2390402Domain d3tjnb_: 3tjn B: [249917]
    automated match to d3tjoa_

Details for d3tjnb_

PDB Entry: 3tjn (more details), 3 Å

PDB Description: HtrA1 catalytic domain, apo form
PDB Compounds: (B:) Serine protease HTRA1

SCOPe Domain Sequences for d3tjnb_:

Sequence, based on SEQRES records: (download)

>d3tjnb_ b.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nslrhkynfiadvvekiapavvhielfrklpfskrevpvasgsgfivsedglivtnahvv
tnkhrvkvelkngatyeakikdvdekadialikidhqgklpvlllgrsselrpgefvvai
gspfslqntvttgivsttqrggkelglrnsdmdyiqtdaiinygnsggplvnldgevigi
ntlkvtagisfaipsdkikkfltes

Sequence, based on observed residues (ATOM records): (download)

>d3tjnb_ b.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nslrhkynfiadvvekiapavvhielfrklpfskrevpvasgsgfivsedglivtnahvv
tnkhrvkvelkngatyeakikdvdekadialikidhqgklpvlllgrsselrpgefvvai
gspfslqntvttgivsttqrggkmdyiqtdaiinygnsggplvnldgevigintlkvtag
isfaipsdkikkfltes

SCOPe Domain Coordinates for d3tjnb_:

Click to download the PDB-style file with coordinates for d3tjnb_.
(The format of our PDB-style files is described here.)

Timeline for d3tjnb_: