Lineage for d3tjke_ (3tjk E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877880Protein automated matches [190100] (21 species)
    not a true protein
  7. 2878164Species Human (Homo sapiens) [TaxId:9606] [187259] (21 PDB entries)
  8. 2878197Domain d3tjke_: 3tjk E: [249915]
    automated match to d1qmva_
    mutant

Details for d3tjke_

PDB Entry: 3tjk (more details), 2.09 Å

PDB Description: Crystal Structure of human peroxiredoxin IV C245A mutant in reduced form
PDB Compounds: (E:) Peroxiredoxin-4

SCOPe Domain Sequences for d3tjke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tjke_ c.47.1.10 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lhlskakiskpapywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgd
rleefrsintevvacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyle
dsghtlrglfiiddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevapagwkpgs
etiipdpagklkyfd

SCOPe Domain Coordinates for d3tjke_:

Click to download the PDB-style file with coordinates for d3tjke_.
(The format of our PDB-style files is described here.)

Timeline for d3tjke_: