Lineage for d1ct1d_ (1ct1 D:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 462850Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 462851Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 462852Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 462853Species Vibrio cholerae [TaxId:666] [50209] (19 PDB entries)
  8. 462924Domain d1ct1d_: 1ct1 D: [24990]

Details for d1ct1d_

PDB Entry: 1ct1 (more details), 2.3 Å

PDB Description: cholera toxin b-pentamer mutant g33r bound to receptor pentasaccharide

SCOP Domain Sequences for d1ct1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ct1d_ b.40.2.1 (D:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslarkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOP Domain Coordinates for d1ct1d_:

Click to download the PDB-style file with coordinates for d1ct1d_.
(The format of our PDB-style files is described here.)

Timeline for d1ct1d_: