Lineage for d1eeig_ (1eei G:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1787828Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1787829Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1787830Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 1787831Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries)
    Uniprot P01556 22-124
  8. 1787916Domain d1eeig_: 1eei G: [24988]
    complexed with gaa

Details for d1eeig_

PDB Entry: 1eei (more details), 2 Å

PDB Description: cholera toxin b-pentamer complexed with metanitrophenyl-alpha-d- galactose
PDB Compounds: (G:) protein (cholera toxin b)

SCOPe Domain Sequences for d1eeig_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eeig_ b.40.2.1 (G:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d1eeig_:

Click to download the PDB-style file with coordinates for d1eeig_.
(The format of our PDB-style files is described here.)

Timeline for d1eeig_: