Lineage for d3tdec3 (3tde C:253-403)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1669649Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 1669650Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 1669749Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 1669750Protein automated matches [254617] (8 species)
    not a true protein
  7. 1669811Species Mycobacterium tuberculosis [TaxId:1773] [256098] (1 PDB entry)
  8. 1669820Domain d3tdec3: 3tde C:253-403 [249872]
    automated match to d1mxaa3
    complexed with na

Details for d3tdec3

PDB Entry: 3tde (more details), 1.85 Å

PDB Description: crystal structure of s-adenosylmethionine synthetase rv1392 from mycobacterium tuberculosis
PDB Compounds: (C:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d3tdec3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tdec3 d.130.1.0 (C:253-403) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
lggpmgdagltgrkiivdtyggwarhgggafsgkdpskvdrsaayamrwvaknvvaagla
ervevqvayaigkaapvglfvetfgtetedpvkiekaigevfdlrpgaiirdlnllrpiy
aptaayghfgrtdvelpweqldkvddlkrai

SCOPe Domain Coordinates for d3tdec3:

Click to download the PDB-style file with coordinates for d3tdec3.
(The format of our PDB-style files is described here.)

Timeline for d3tdec3: