Lineage for d3tdca2 (3tdc A:2043-2451)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100173Species Human (Homo sapiens) [TaxId:9606] [226449] (5 PDB entries)
  8. 2100187Domain d3tdca2: 3tdc A:2043-2451 [249863]
    automated match to d4asib2
    complexed with 0eu

Details for d3tdca2

PDB Entry: 3tdc (more details), 2.41 Å

PDB Description: Crystal Structure of Human Acetyl-CoA carboxylase 2
PDB Compounds: (A:) Acetyl-CoA carboxylase 2 variant

SCOPe Domain Sequences for d3tdca2:

Sequence, based on SEQRES records: (download)

>d3tdca2 c.14.1.0 (A:2043-2451) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hspvpiitptdpidreieflpsrapydprwmlagrphptlkgtwqsgffdhgsfkeimap
waqtvvtgrarlggipvgviavetrtvevavpadpanldseakiiqqagqvwfpdsaykt
aqaikdfnreklplmifanwrgfsggmkdmydqvlkfgayivdglrqykqpiliyippya
elrggswvvidatinplciemyadkesrggvlepegtveikfrkkdliksmrridpaykk
lmeqlgepdlsdkdrkdlegrlkaredlllpiyhqvavqfadfhdtpgrmlekgvisdil
ewktartflywrlrrllledqvkqeilqasgelshvhiqsmlrrwfvetegavkaylwdn
nqvvvqwleqhwqagdgprstirenitylkhdsvlktirglveenpeva

Sequence, based on observed residues (ATOM records): (download)

>d3tdca2 c.14.1.0 (A:2043-2451) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hspvpiitptdpidreieflpsrapydprwmlagrphptlkgtwqsgffdhgsfkeimap
waqtvvtgrarlggipvgviavetrtvevavpadpanldseakiiqqagqvwfpdsaykt
aqaikdfnreklplmifanwrgfsggmkdmydqvlkfgayivdglrqykqpiliyippya
elrggswvvidatinplciemyadkesrggvlepegtveikfrkkdliksmrridpaykk
lmeqlgepdlsdkdrkdlegrlkaredlllpiyhqvavqfadfhdtpgrmlekgvisdil
ewktartflywrlrrllledqvkqeilqasgelshvhiqsmlrrwfvetegavkaylwdn
nqvvvqwleqhwitylkhdsvlktirglveenpeva

SCOPe Domain Coordinates for d3tdca2:

Click to download the PDB-style file with coordinates for d3tdca2.
(The format of our PDB-style files is described here.)

Timeline for d3tdca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tdca1