![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
![]() | Protein automated matches [190246] (68 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226449] (5 PDB entries) |
![]() | Domain d3tdca1: 3tdc A:1719-2042 [249862] automated match to d4asib1 complexed with 0eu |
PDB Entry: 3tdc (more details), 2.41 Å
SCOPe Domain Sequences for d3tdca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tdca1 c.14.1.0 (A:1719-2042) automated matches {Human (Homo sapiens) [TaxId: 9606]} tpyvtkdllqakrfqaqtlgttyiydfpemfrqalfklwgspdkypkdiltytelvldsq gqlvemnrlpggnevgmvafkmrfktqeypegrdvivignditfrigsfgpgedllylra semaraegipkiyvaansgarigmaeeikhmfhvawvdpedphkgfkylyltpqdytris slnsvhckhieeggesrymitdiigkddglgvenlrgsgmiagesslayeeivtislvtc raigigaylvrlgqrviqvenshiiltgasalnkvlgrevytsnnqlggvqimhyngvsh itvpddfegvytilewlsympkdn
Timeline for d3tdca1: