SCOPe 2.07: Domain d3tdca1: 3tdc A:1719-2042

Lineage for d3tdca1 (3tdc A:1719-2042)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (68 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226449] (5 PDB entries)

8. Domain d3tdca1: 3tdc A:1719-2042 [249862]
   automated match to d4asib1
   complexed with 0eu

Details for d3tdca1

PDB Entry: 3tdc, 2.41 Å

PDB Description: Crystal Structure of Human Acetyl-CoA carboxylase 2

PDB Compounds: (A:) Acetyl-CoA carboxylase 2 variant

SCOPe Domain Sequences for d3tdca1:

Sequence; same for both SEQRES and ATOM records:

>d3tdca1 c.14.1.0 (A:1719-2042) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpyvtkdllqakrfqaqtlgttyiydfpemfrqalfklwgspdkypkdiltytelvldsq
gqlvemnrlpggnevgmvafkmrfktqeypegrdvivignditfrigsfgpgedllylra
semaraegipkiyvaansgarigmaeeikhmfhvawvdpedphkgfkylyltpqdytris
slnsvhckhieeggesrymitdiigkddglgvenlrgsgmiagesslayeeivtislvtc
raigigaylvrlgqrviqvenshiiltgasalnkvlgrevytsnnqlggvqimhyngvsh
itvpddfegvytilewlsympkdn

Timeline for d3tdca1:

• d3tdca1 first appeared in SCOPe 2.04
  
• d3tdca1 appears in SCOPe 2.06