SCOPe 2.05: Domain d1eeie_: 1eei E:

Lineage for d1eeie_ (1eei E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Cholera toxin [50208] (1 species)
   barrel, partly opened; n*=5, S*=10

7. Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries)
   Uniprot P01556 22-124

8. Domain d1eeie_: 1eei E: [24986]
   complexed with gaa

Details for d1eeie_

PDB Entry: 1eei, 2 Å

PDB Description: cholera toxin b-pentamer complexed with metanitrophenyl-alpha-d- galactose

PDB Compounds: (E:) protein (cholera toxin b)

SCOPe Domain Sequences for d1eeie_:

Sequence; same for both SEQRES and ATOM records:

>d1eeie_ b.40.2.1 (E:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

Timeline for d1eeie_:

• d1eeie_ first appeared (with stable ids) in SCOP 1.55
  
• d1eeie_ appears in SCOPe 2.04
  
• d1eeie_ appears in SCOPe 2.06
  
• d1eeie_ appears in the current release, SCOPe 2.08