SCOPe 2.08: Domain d3tava1: 3tav A:3-265

Lineage for d3tava1 (3tav A:3-265)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.0: automated matches [194833] (1 protein)
   not a true family

6. Protein automated matches [194834] (4 species)
   not a true protein

7. Species Mycobacterium abscessus [TaxId:561007] [256096] (1 PDB entry)

8. Domain d3tava1: 3tav A:3-265 [249857]
   Other proteins in same PDB: d3tava2, d3tavb2
   automated match to d3mx6b_
   complexed with cl, lmr, mg, mlt, na

Details for d3tava1

PDB Entry: 3tav, 2.15 Å

PDB Description: crystal structure of a methionine aminopeptidase from mycobacterium abscessus

PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d3tava1:

Sequence; same for both SEQRES and ATOM records:

>d3tava1 d.127.1.0 (A:3-265) automated matches {Mycobacterium abscessus [TaxId: 561007]}
glfgrkktveqrtpgeldamaaagsivgaalvavrdaakagvstleldqvaesvireaga
vpsflgyhgfpasicssvndqvvhgipsatavladgdlvsidcgaildgwhgdsawtfav
gtvipsdealseatrlsmeagiaamipgnrltdvshaielgtraaekqfdrafgivdgyg
ghgigrsmhldpflpnegapgkgpllavgsvlaiepmltlgttqtrvladdwtvvttdgs
raahwehtvavteagpriltmrp

Timeline for d3tava1:

• d3tava1 first appeared in SCOPe 2.04, called d3tava_
  
• d3tava1 appears in SCOPe 2.07