Lineage for d3tagc2 (3tag C:376-903)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3016466Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3016563Protein Family B DNA polymerase [56680] (7 species)
  7. 3016564Species Bacteriophage RB69 [TaxId:12353] [56681] (93 PDB entries)
  8. 3016688Domain d3tagc2: 3tag C:376-903 [249854]
    Other proteins in same PDB: d3taga1, d3taga3, d3tagb1, d3tagc1, d3tagd1
    automated match to d3l8bb2
    protein/DNA complex; complexed with so4

Details for d3tagc2

PDB Entry: 3tag (more details), 2.95 Å

PDB Description: 5-fluorocytosine paired with damp in rb69 gp43
PDB Compounds: (C:) DNA polymerase

SCOPe Domain Sequences for d3tagc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tagc2 e.8.1.1 (C:376-903) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmfdf

SCOPe Domain Coordinates for d3tagc2:

Click to download the PDB-style file with coordinates for d3tagc2.
(The format of our PDB-style files is described here.)

Timeline for d3tagc2: