SCOPe 2.04: Domain d3t8ya_: 3t8y A:

Lineage for d3t8ya_ (3t8y A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (54 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [188956] (11 PDB entries)

8. Domain d3t8ya_: 3t8y A: [249836]
   automated match to d3kyjb_
   complexed with pb

Details for d3t8ya_

PDB Entry: 3t8y, 1.9 Å

PDB Description: Crystal structure of the response regulator domain of Thermotoga maritima CheB

PDB Compounds: (A:) Chemotaxis response regulator protein-glutamate methylesterase

SCOPe Domain Sequences for d3t8ya_:

Sequence; same for both SEQRES and ATOM records:

>d3t8ya_ c.23.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
rvirvlvvddsafmrmvlkdiidsqpdmkvvgfakdgleavekaielkpdvitmdiempn
lngiealklimkkaptrvimvsslteegaaitiealrngavdfitkphgsisltfrqvap
ellekirqamnvdp

Timeline for d3t8ya_:

• d3t8ya_ is new in SCOPe 2.04-stable
  
• d3t8ya_ appears in SCOPe 2.05
  
• d3t8ya_ appears in the current release, SCOPe 2.08