![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.3: Crotonase-like [52103] (14 proteins) |
![]() | Protein automated matches [190669] (6 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [256094] (1 PDB entry) |
![]() | Domain d3t8ac_: 3t8a C: [249835] automated match to d1rjnb_ complexed with s0n |
PDB Entry: 3t8a (more details), 2.25 Å
SCOPe Domain Sequences for d3t8ac_:
Sequence, based on SEQRES records: (download)
>d3t8ac_ c.14.1.3 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} sdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldh armspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasgdtadtvdvaragrlh ilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyarfkqtdadvgsfdggy gsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaeletvglqwaaeinaksp qaqrmlkfafnllddglvgqqlfageatrlaymtd
>d3t8ac_ c.14.1.3 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} sdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldh armspdvgvvlltgngpspkdggwafcsggdqrlhilevqrlirfmpkvviclvngwaag gghslhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtyt aeqmhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfag eatrlaymtd
Timeline for d3t8ac_: